Quick Links
Browse By Peptide
- 5-Amino-1MQ
- Ac Sdkp Goralatide
- Ace 031
- Acetic Acid
- Acetyl Hexapeptide 3 Argireline
- Adamax
- Adipotide
- Ahk Cu
- Aicar
- Akg
- Alprostadil
- Aod 9604
- Ara 290
- Bacteriostatic Water
- Bam 15
- Bpc 157
- Bpc 157 Tb 500
- Bronchogen
- Ca Akg
- Cagrilintide
- Cardiogen
- Cartalax
- Cerebrolysin
- Chonluten
- Cjc 1295 Dac
- Cjc 1295 No Dac
- Cjc 1295 No Dac Ipamorelin
- Cortagen
- Cortagen Peptide Research Guide
- Crystagen
- Dermorphin
- Dihexa
- Dsip
- Epithalon
- Follistatin 344
- Foxo4 Dri
- Ghk Cu
- Ghrp 2
- Ghrp 6
- Glow
- Glutathione
- Gonadorelin
- Gotratix A18
- Hexarelin
- Hgh Fragment 176 191
- Humanin
- Hyaluronic Acid
- Igf 1 Des
- Igf 1 Lr3
- Ipamorelin
- Kisspeptin 10
- Klow
- Kpv
- Liraglutide
- Ll37
- Matrixyl 3000 Complex
- Mazdutide
- Melanotan I
- Melanotan Ii
- Methylene Blue
- Mgf
- Mk 677 Ibutamoren
- Mots C
- Na Epitalon Amidate
- Na Selank
- Na Semax
- Nad
- Nad Plus
- Nmn
- Nmnh
- Nonapeptide 1
- Ovagen
- Oxytocin
- Pal Ghk Peptide
- Pancragen
- Pe 22 28
- Peg Mgf
- Pentapeptide 18 Leuphasyl
- Pinealon
- Pnc 27
- Prostamax
- Pt 141
- Ptd Dbm
- Reconstitution Solution
- Resveratrol
- Retatrutide
- Retatrutide Cagrilintide
- Selank
- Semaglutide
- Semaglutide Cagrilintide
- Semax
- Sermorelin
- Servodutide
- Slu Pp 332
- Slu Pp 332 Bam15
- Snap 8
- Ss 31
- Survodutide
- Syn Ake
- Syn Coll Peptide
- Tb 500
- Tb 500 Frag
- Teriparatide
- Tesamorelin
- Tesamorelin Ipamorelin
- Tesamorelinipamorelin
- Tesofensene
- Tesofensine
- Testagen
- Thymalin
- Thymosin Alpha
- Thymosin Beta 4
- Tirzepatide
- Triptorelin
- Vesugen
- Vilon
- Vip
- Vip Peptide
Browse By Application
- Addiction
- Alzheimers
- Anti Aging
- Antimicrobial
- Anxiety
- Appetite
- Autoimmune Disorders
- Bladder Urinary Health
- Body Composition
- Bone Joint Health
- Cancer
- Cardiovascular Health
- Cellular Energy
- Circadian Health
- Cognitive Enhancement
- Cosmetic
- Crohns Disease
- Depression
- Diabetes
- Ear Hearing Health
- Endocrine Health
- Epigenetics
- Eye Health
- Fat Oxidation
- Fertility
- Glp
- Growth Hormone Optimization
- Gut Health
- Hair Scalp Health
- Hormonal Balance
- Immune System Support
- Immunomodulation
- Infection
- Inflammation
- Inflammatory Bowel Disease
- Injury Recovery
- Irritable Bowel Syndrome
- Kidney Health
- Leaky Gut
- Libido
- Liver Health
- Longevity
- Menopause
- Mens Health
- Mental Health
- Metabolic Health
- Mitochondrial Health
- Muscle Growth
- Neural Regeneration
- Neurodegenerative Diseases
- Neuroprotection
- Oncology
- Oral Dental Health
- Osteoporosis
- Pain Management
- Parkinsons
- Perimenopause
- Polycystic Ovary Syndrome
- Post Traumatic Stress Disorder
- Respiratory Health
- Sexual Health
- Skin
- Sleep
- Spinal Cord Injury
- Sports Performance
- Telomere Biology
- Thyroid
- Tissue Repair
- Weight Loss
- Womens Health
- Wound Healing
VIP Peptide: The Complete Guide to Vasoactive Intestinal Peptide
AI Summary
VIP (Vasoactive Intestinal Peptide) is a naturally occurring 28-amino acid neuropeptide produced throughout the human body - in the gut, nervous system, and immune cells - that regulates inflammation, blood vessel tone, airway function, and immune cell behavior. Its synthetic pharmaceutical form, aviptadil, has been studied in clinical trials for respiratory conditions, autoimmune disease, and COVID-19. This guide covers what VIP does, how it works at a molecular level, what the clinical research shows, documented dosing protocols, safety considerations, and its current regulatory status.Quick Facts
| Field | Detail |
|---|---|
| Aliases / AKA's | Vasoactive Intestinal Peptide; VIP; Aviptadil (synthetic pharmaceutical form); ZYESAMI (brand name in COVID-19 trial context) |
| Class | 28-amino acid endogenous neuropeptide; secretin/glucagon superfamily |
| Typical administration routes | Intranasal / Nebulized / SubQ / IV (clinical/research settings) |
| Overall evidence grade | Moderate, human safety data established; efficacy trial evidence mixed, with largest IV trial halted for futility; strong mechanistic and animal data |
| Regulatory status | Not FDA-approved for general therapeutic use; available through compounding pharmacies under physician supervision; compounding access under FDA review |
| Last updated | July 2026 |
What VIP Does & How It Works
What It Does - Functional Outcomes
- Shifts the immune system from pro-inflammatory activity toward regulated, tolerant immune states, which is the primary mechanism behind its studied autoimmune applications
- Dilates blood vessels and relaxes airway smooth muscle, producing bronchodilatory effects relevant to asthma, COPD, and pulmonary hypertension research
- Coordinates the body's circadian rhythm; VIP plays a documented role in the biological clock
- Protects neurons from inflammatory damage in animal models of Parkinson's disease
- Supports the integrity and secretory function of the gut lining by promoting the specialized cells that produce mucus and antimicrobial proteins
- Corrects dysregulated inflammatory markers (C4a, TGF-beta1, MMP9) in documented CIRS protocols
- Reduces expression and enzymatic activity of proteins that SARS-CoV-2 uses to enter human cells, in cell culture studies
How It Works - Mechanism of Action
VPAC1/VPAC2 Receptor Binding and cAMP Signaling
(Evidence: Animal + in vitro)
VIP binds two receptors called VPAC1 and VPAC2. These are G-protein-coupled receptors - proteins embedded in the cell surface that act as switches for internal signaling cascades - and they are expressed across the gut, nervous system, immune cells, and vascular smooth muscle. When VIP docks into one of these receptors, it activates an enzyme called adenylyl cyclase. That enzyme raises levels of a messenger molecule inside the cell called cAMP (cyclic adenosine monophosphate), which functions as a chemical relay signal. The cAMP signal then activates PKA (protein kinase A), an enzyme that carries the signal forward to produce VIP's downstream effects, including vasodilation and smooth muscle relaxation. VPAC1 and VPAC2 differ in tissue distribution and binding affinity, which explains why VIP produces effects across such a wide range of biological systems.
Regulatory T Cell Induction and Immune Tolerance
VIP suppresses pro-inflammatory Th1 cells (the immune cell type that drives inflammation against pathogens) and Th17 cells (the immune cell type that drives autoimmune-style tissue inflammation). At the same time, it induces Th2 and Treg (regulatory T cell) profiles. Tregs are the immune cell population whose job is to prevent the immune system from attacking the body's own tissues. The Tregs generated are specifically the CD4+CD25+FoxP3+ subtype, named for three surface markers that identify them. VIP also induces tolerogenic dendritic cells, which are immune cells shifted into a state that generates additional peripheral Tregs rather than triggering inflammation.
Critically, this Treg induction occurs even in animal models depleted of CD25-expressing cells. This means the induction pathway does not depend entirely on pre-existing Treg precursors, a finding that strengthens the mechanistic case for VIP in conditions where Tregs are already depleted.
VPAC2-Mediated Neuroprotection via Astrocyte Activation
VPAC2 receptor activation in white matter astrocytes triggers PKC and MAPK signaling cascades. Astrocytes are the brain's support cells, which maintain and protect neurons. PKC (protein kinase C) is an enzyme involved in cell signaling, and MAPK (mitogen-activated protein kinase) is a family of enzymes that relay signals controlling cell survival and stress responses. These cascades produce neurotrophic effects in distant cortical neurons. VIP also enhances the release of ADNF (activity-dependent neurotrophic factor) and ADNP (activity-dependent neuroprotective protein), two proteins that directly support neuronal survival. This means VIP can protect neurons at a distance from where it actually binds, working through the brain's own support cell network rather than acting directly on neurons.
p38 MAPK Activation and Gut Secretory Cell Differentiation
VIP promotes differentiation of intestinal stem cells into secretory cell lineages. The primary pathway is p38 MAPK activation (p38 MAPK is one branch of the MAPK signaling family, involved in directing how stem cells specialize into specific cell types). MEK1 (a related kinase enzyme in a parallel signaling branch) contributes as a secondary mechanism. This drives expansion of Paneth cells (Lyz1+) and goblet cells (Muc2+), which are the specialized cells that maintain the gut's antimicrobial and mucus layers. VIP knockout animal models show reduced secretory markers, and the effect is reversible with exogenous VIP administration. That reversibility establishes a direct causal relationship between VIP signaling and gut secretory cell maintenance.
VIP Molecular Profile
| Field | Detail |
|---|---|
| CAS Number | 40077-57-4 (human/porcine/rat; most commonly cited); 37221-79-7 appears in some PubChem records - variation reflects differences in exact substance definition |
| Molecular Formula | C147H238N44O42S (Sigma-Aldrich); note: slight variation across suppliers due to salt form differences (TFA salt vs. free base) |
| Molecular Weight | 3325.80 Da (Sigma-Aldrich); 3323.77 Da (Echelon, TFA salt form) |
| Peptide Length | 28 amino acids |
| Sequence (1-letter) | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Known modifications | C-terminal amidation (-NH2) |
| Salt form | TFA (trifluoroacetate) salt in some research preparations; free base in others - accounts for molecular weight variation across suppliers |
Structure reference: View on PubChem, Compound CID 53314964 - Publishing team: retrieve 2D structure image from this link.
VIP Uses & Benefits
Autoimmune and Inflammatory Conditions
VIP is most studied for autoimmune and inflammatory conditions where an overactive Th1/Th17 (pro-inflammatory immune cell) response drives disease. Researchers have documented significant effects in animal models of rheumatoid arthritis, colitis, and multiple sclerosis, consistently reducing disease severity through Treg induction and cytokine suppression. The human evidence lags behind the animal data, but the mechanistic rationale is among the most well-characterized in peptide research. Users and practitioners drawn to VIP for autoimmune applications are working from a solid mechanistic foundation, even if controlled human efficacy trials are sparse. (Evidence: Animal + in vitro - Abad et al., 2010, PMC)
CIRS - Chronic Inflammatory Response Syndrome
Compounded nasal VIP is a component of the Shoemaker protocol for CIRS, a condition associated with biotoxin exposure (most commonly water-damaged buildings and mold). In documented clinical protocols lasting up to 18 months, nasal VIP use was associated with correction of characteristically dysregulated inflammatory markers - specifically C4a, TGF-beta1, and MMP9 - as well as hormonal normalization and improvement in pulmonary pressure readings. This is protocol-level evidence rather than controlled trial evidence, but it represents the most extended human use documentation available for VIP. (Evidence: Protocol-level clinical documentation - ISEAI)
Pulmonary Hypertension and Respiratory Conditions
VIP is a potent bronchodilator acting directly on airway smooth muscle, making it a therapeutic target in asthma, COPD, and sarcoidosis research. The pulmonary hypertension case is particularly compelling: VIP deficiency has been confirmed as a diagnostic marker in the serum and lung tissue of pulmonary hypertension patients, suggesting the condition involves disrupted endogenous VIP signaling. A VIP-elastin-like peptide fusion protein received FDA orphan drug designation for pulmonary arterial hypertension (not approval, but formal acknowledgment of therapeutic potential). A Phase 2 sarcoidosis trial of nebulized VIP established a clean 4-week safety profile with no serious adverse events. (Evidence: Moderate - animal + limited human)
Neuroprotection and Neurological Support
In animal models of Parkinson's disease, VIP prevented the loss of dopaminergic neurons in the substantia nigra by suppressing neuroinflammatory microglial activation. Measured outcomes included improved dopamine and DOPAC (3,4-dihydroxyphenylacetic acid, a metabolite of dopamine used as a marker of dopaminergic neuron activity) levels, reduced oxidative stress markers, and preserved neuronal structure in areas relevant to Parkinson's pathology. VIP also plays a documented role in coordinating circadian rhythms and has been explored for anxiety and mood applications based on its influence on brain connectivity and plasma level associations. Intranasal delivery achieves higher brain concentrations than IV administration, a relevant pharmacokinetic advantage for CNS applications. (Evidence: Animal - Delgado & Ganea, 2003, PMC)
Gut Health and Intestinal Barrier Function
VIP regulates intestinal secretory cell populations and epithelial tight junctions. In vitro organoid studies document VIP-driven expansion of Paneth cells and goblet cells, the specialized secretory populations that maintain the gut's antimicrobial and mucus layers. VIP knockout mice show reduced secretory markers and increased colonic permeability, both of which are reversed with exogenous VIP. Elevated VIP nerve fiber density has also been observed in Crohn's disease patients, suggesting a compensatory response to intestinal inflammation. (Evidence: In vitro + animal)
Antiviral Research (SARS-CoV-2)
Cell culture research demonstrated that VIP reduces both the expression and enzymatic activity of ACE2 and TMPRSS2, the two proteins SARS-CoV-2 uses to enter human cells, with TMPRSS2 enzymatic activity reduced substantially in these studies. Aviptadil (synthetic VIP) was investigated in COVID-19 respiratory failure under an expanded access protocol. The Phase 3 IV trial in this context was halted for futility, representing the largest VIP clinical trial to date and its most significant negative result. (Evidence: In vitro + expanded access clinical)
Where This Guide Comes From
Where this guide comes from
Most peptide guides are written from whatever the author could find on the internet. This one is built on something different. The MyPeptidePal Knowledge Base aggregates every published clinical study, peer-reviewed trial, in vitro finding, and documented human use case on peptides into a single continuously updated system. What makes it unique is the layer on top of the published literature: MyPeptidePal currently tracks over 10,000 active user protocols every day, with more than 900 new protocols created and refined daily by real users logging their actual results.
That means the dosing ranges, outcome timelines, and safety notes in this guide are not only sourced from published literature — they are cross-referenced against real-world protocol data from thousands of people actively using these compounds. When the research and the real-world data agree, we say so. When they diverge, we note it. The goal is the clearest, most complete picture of what the evidence actually shows.
VIP Results & Timelines
Inflammatory Marker Correction and Immune Modulation
- Week 1-2: Effects in the first one to two weeks are often subtle and not the primary signal; some users report mild flushing or warmth at the time of administration, which reflects VIP's vasodilatory activity rather than an immune effect
- Week 3-6: Subjective changes in energy, cognitive clarity, and sleep quality are among the early-reported signals in CIRS and immune-focused protocols; laboratory markers at this stage may begin to show directional movement
- Week 6-12: Documented compounding protocols for CIRS show measurable correction of inflammatory markers (C4a, TGF-beta1, MMP9) and hormonal normalization appearing within this window with consistent use
- Beyond 12 weeks: The most extended documentation, from 18-month CIRS protocols, shows sustained correction of inflammatory markers with ongoing use; individual response and the underlying condition being addressed determine how long continuous use is warranted
Respiratory and Pulmonary Applications
- Acute administration: Bronchodilatory effects with nebulized VIP can be relatively rapid; airway smooth muscle relaxation is a direct pharmacological effect rather than a downstream immune outcome
- Week 1-4: The Phase 2 sarcoidosis nebulization trial established a 4-week safety profile; pulmonary function changes over this timeframe were the primary measured outcome
- Longer term: Pulmonary pressure improvements are documented in CIRS protocols over months of consistent use, suggesting gradual rather than acute pulmonary effects with systemic administration
Neurological Applications
- Week 1-2: Circadian rhythm effects (improved sleep quality and rhythm consistency) are among the more commonly reported early signals in neurological application protocols
- Week 4-8: Mood and anxiety-related outcomes are typically reported over a multi-week timeframe; individual variation is substantial
- Beyond 8 weeks: Neuroprotective outcomes in animal models required sustained exposure; no human timeline data exists for the Parkinson's-related applications
How to Administer VIP
Intranasal
Intranasal administration is the most common compounded delivery format for VIP outside of clinical trial settings. Documented compounding protocols use nasal spray devices delivering 50 mcg per nostril per actuation. The pharmacokinetically interesting finding here is that intranasal delivery achieves higher brain concentrations than intravenous administration, likely via olfactory pathway transport. This makes it particularly relevant for CNS and neurological applications despite being the less invasive route. The 18-month CIRS protocol using this delivery format produced no serious adverse events, establishing the strongest human safety documentation available for VIP at any route.
Nebulized
Nebulized VIP delivers the compound directly to airway tissues, making it the most directly relevant route for pulmonary and respiratory applications. A Phase 2 sarcoidosis trial using nebulized VIP over 4 weeks established safety with no serious adverse events, and the route avoids the systemic cardiovascular effects that make IV administration problematic at higher doses. Nebulized delivery concentrates VIP at the intended pulmonary target while reducing systemic exposure.
Subcutaneous Injection (SubQ)
Subcutaneous injectable VIP is available through compounding pharmacies and appears in documented protocols at 50-200 mcg per injection. The SubQ route provides systemic absorption without the acute cardiovascular risk profile associated with rapid IV delivery. No formal pharmacokinetic study comparing SubQ bioavailability to other routes has been published for VIP specifically; the route is used in practice based on general peptide pharmacokinetic principles and compounding protocol experience.
Intravenous (IV)
IV administration was the route used in the formal Phase 1 ARDS/sepsis trial, the migraine provocation study, and the Phase 3 trial halted for futility. It produces the most predictable and rapid systemic exposure but also the most pronounced dose-limiting cardiovascular effects. Hypotension and tachycardia are consistently documented at IV doses in research settings, with 6-12 hour infusion protocols used rather than bolus administration. IV VIP is a clinical and research route, not a compounding protocol route.
Oral
Oral VIP is not viable. VIP is a 28-amino acid peptide degraded by gastric acid and digestive enzymes before reaching systemic circulation in meaningful concentrations. The same rapid enzymatic degradation that limits single-dose IV efficacy and drove the development of VIP-SSM nanoparticle formulations applies even more completely to the oral route. No oral VIP formulation has demonstrated systemic bioavailability in published research.
VIP Dosage & Cycle Length
Overall dosing range: 50-400 mcg per day (intranasal); 50-200 mcg per injection (subcutaneous) - range varies significantly by route, goal, and individual
How the goal shifts where you land:
- Low end of range: 50 mcg per nostril commonly associated with maintenance and inflammatory marker monitoring in documented CIRS protocols
- Mid range: 200-400 mcg per day intranasal (across multiple daily administrations) represents the most documented compounding protocol range for systemic immune and inflammatory applications
- High end of range: 200 mcg per subcutaneous injection is the upper bound reported in injectable protocols, sometimes used for more active inflammatory or pulmonary management goals (evidence grade: Limited clinical / protocol-level)
Frequency: Intranasal protocols typically document 4 administrations per day. Injectable protocols most commonly report 5 times per week dosing.
Cycle length: Injectable protocols typically follow a 3-month on / 1-month off structure based on documented compounding protocols. Intranasal protocols have been run continuously for up to 18 months in CIRS clinical documentation without serious adverse events; the cycle structure for nasal use appears more flexible and individualized.
Loading protocols: No loading protocol is documented in available literature for VIP. Standard dosing begins at the therapeutic range from day one in documented protocols.
Important
The ranges above are general information drawn from published research and real-world protocol data — not a dosing recommendation for you specifically. Optimal dosing for Vip Peptide depends on your health history, body weight, goals, other compounds being used, and individual response. Always consult a qualified healthcare professional before starting any peptide protocol.
→ Build your personalized Vip Peptide protocol inside MyPeptidePal — free, in under 60 seconds.
VIP Vial Sizes, Costs & Quality
Common vial sizes: 1 mg, 5 mg, and 10 mg vials (research-grade lyophilized); 10 cc nasal spray vials at 500 mcg/cc (compounded, approximately 30-day supply at typical dosing)
Typical cost range: Research-grade lyophilized vials vary widely, from approximately $42 for basic research vials to $179 or more for 1 mg vials from specialty biochemical suppliers. Compounded nasal spray programs run approximately $189-$230 per month depending on the pharmacy. Injectable compounded VIP is generally in a similar monthly range, reflecting the higher synthesis complexity of a 28-amino acid peptide relative to shorter compounds.
Storage - lyophilized (dry powder):
- Temperature: -20 degrees C for long-term storage; stable at this temperature for up to 12 months
- Shelf life: Approximately 12 months at -20 degrees C prior to reconstitution
- Light sensitivity: Protect from light; store in amber or opaque containers where possible
Storage - reconstituted (in solution):
- Temperature: Refrigerate at 2-8 degrees C after reconstitution
- Use window: VIP degrades relatively quickly in solution, which is the same challenge that drove development of VIP-SSM nanoformulations in research settings; use reconstituted solution promptly and do not hold for extended periods
Normal appearance after reconstitution: VIP reconstitutes into a clear, colorless solution. At 28 amino acids with C-terminal amidation as its only modification, it dissolves cleanly in standard reconstitution solution without visible particulate or unusual coloration.
Signs of degradation: Cloudiness or visible particulates in a solution that should be clear, yellowing or other discoloration, or an unusual odor are all indicators the solution has degraded and should not be used. Given VIP's known instability in solution, degradation is a genuine practical concern, not a theoretical one.
Quality Considerations
VIP is a 28-amino acid peptide with C-terminal amidation, a more complex synthesis target than shorter peptides, and one where shortcuts in purification or quality control produce a measurably inferior product. The peptide degrades quickly in solution, which means a product that was not properly lyophilized, stored, or shipped is likely to have reduced potency before it ever reaches the user. Overseas suppliers with no third-party testing or documented quality controls cannot confirm what is actually in the vial, and for a compound where the therapeutic rationale depends on a specific 28-amino acid sequence with precise modifications, sequence errors or impurities are not trivial concerns. U.S.-manufactured research peptides come with documented synthesis standards, third-party certificates of analysis, and full chain of custody from production to shipment - the kind of accountability that provides a reasonable basis for trusting what is in the vial.
Why USA-manufactured peptides matter
Most peptides available online are sourced from unregulated overseas labs with no standardized testing requirements, no verified quality controls, and no accountability if a product is contaminated or misdosed. USA-manufactured peptides cost more, but they come with third-party testing, verifiable certificates of analysis, and domestic accountability. When you are injecting a compound, the sourcing decision matters as much as the dosing decision.
MyPeptidePal members get access to our community-vetted supplier directory inside the app — listing only USA-based manufacturers and verified international suppliers that have passed our review process. Find vetted suppliers inside MyPeptidePal →
VIP Side Effects & Safety
Side Effect Spectrum
| Common | Less Common | Rare / Serious |
|---|---|---|
| Flushing and warm sensations | Headache | Severe hypotension (documented with high-dose IV) |
| Hypotension (low blood pressure) | Dizziness | Significant tachycardia requiring medical attention |
| Tachycardia and heart palpitations | Abdominal discomfort / nausea | Watery-diarrhea syndrome (documented at higher systemic exposures) |
| Nasal irritation (nasal spray formulations) | Photophobia | |
| Cold sensations alternating with flushing |
Contraindications
- Active or suspected malignancy: VIP has documented proangiogenic potential, meaning it promotes new blood vessel growth, which theoretically can support tumor growth. This is listed as a precaution in compounding product materials. Direct evidence of VIP promoting cancer progression in humans is not established, but the biological mechanism warrants caution.
- Pre-existing clinically significant hypotension: VIP is a potent vasodilator; use in individuals with already-low blood pressure carries meaningful cardiovascular risk based on the documented dose-limiting side effect profile across routes.
- Active cardiac arrhythmia or unexplained palpitations: Tachycardia and palpitations are consistently documented across routes; adding VIP to an already-unstable cardiac rhythm picture requires clinician evaluation before proceeding.
Populations Where Caution Is Warranted
- Pregnancy and breastfeeding: Safety not established for compounded VIP products; use is not recommended without medical supervision
- Pediatric use: Not studied in pediatric populations; not appropriate without medical supervision
- Active infection: Clinician review recommended; VIP's immune-modulating effects shift immunity toward a more tolerant, regulatory profile, which has theoretical implications for mounting acute infectious immune responses
- Individuals with pre-existing atopic conditions: Animal research shows VPAC2-overexpressing mice develop elevated IgE, eosinophilia, and hypersensitivity shifts toward allergic phenotypes; clinical significance in humans is unknown but worth noting
Red Flags - Stop Use and Seek Medical Attention If:
- Significant or sudden drop in blood pressure accompanied by lightheadedness or near-fainting
- Sustained rapid or irregular heartbeat that does not resolve within 30-60 minutes of administration
- Severe or persistent nausea with profuse watery diarrhea
- Any new or unexplained cardiovascular symptom following administration
Drug and Compound Interactions
No formal drug interaction studies have been conducted for compounded VIP preparations. Based on its vasodilatory mechanism, theoretical interaction concerns include additive hypotensive effects when combined with antihypertensive medications, other vasodilators, or compounds with blood-pressure-lowering properties. VIP's shift of immune activity toward a Th2 and regulatory profile is also theoretically relevant when combined with immunosuppressive medications, though no specific interaction data is published. Anyone taking cardiovascular medications or immunomodulatory drugs should discuss VIP use with a qualified clinician before starting.
Side effects and contraindications listed here are drawn from published studies, documented case reports, and user protocol data. This section is informational only and does not constitute medical advice or guidance. Individual responses vary. Always consult a qualified healthcare professional before starting, stopping, or modifying any peptide protocol.
VIP Research & Studies
Pharmacokinetics & Metabolism
Absorption & Bioavailability VIP's pharmacokinetics vary significantly by route. Intranasal delivery achieves higher brain concentrations than intravenous administration. This counterintuitive finding is well-documented and has made intranasal the preferred route for CNS research applications. Bioavailability data for compounded subcutaneous VIP in humans is not formally published; the SubQ route is extrapolated from general peptide pharmacokinetics rather than VIP-specific human studies.
Distribution VIP is widely distributed, produced endogenously in the gut, nervous system, and immune cells, with VPAC1 and VPAC2 receptors expressed across these same systems. Intranasal delivery preferentially delivers higher concentrations to brain tissue relative to IV, likely via olfactory pathway transport. Whether subcutaneous exogenous VIP reaches CNS tissue at meaningful concentrations has not been directly measured in published human research.
Half-Life VIP has a short plasma half-life estimated at approximately 1-2 minutes in circulation, based on intravenous administration studies. Rapid enzymatic degradation in plasma and tissue is the primary reason VIP-SSM nanoformulations were developed for preclinical research. This rapid clearance explains why compounding protocols use multiple daily administrations rather than a single daily dose.
Metabolism & Elimination VIP is degraded by endopeptidases and exopeptidases (enzymes that break peptides apart from the middle and from the ends, respectively) in plasma and tissues. No hepatic metabolism pathway creating active metabolites has been documented. VIP is broken down into amino acid fragments eliminated through standard pathways. Route of administration significantly determines how much intact VIP reaches target tissues.
Mechanistic Research
Th1-to-Treg Immune Shift (Evidence: Animal + in vitro - Gonzalez-Rey et al., 2006, JCI)
VIP consistently shifts immune activity away from Th1 (pro-inflammatory) and Th17 (autoimmune-driving) phenotypes toward Th2 and regulatory T cell profiles across multiple disease models. The CD4+CD25+FoxP3+ cells that VIP generates are identified by those three surface markers and are the immune population central to immune tolerance. Loss of this Treg population characterizes many autoimmune conditions.
Critically, VIP generates peripheral Tregs even in CD25-depleted animal models. This means the induction pathway does not depend entirely on existing Treg precursors, a finding that strengthens the mechanistic case for VIP in conditions where Tregs are already depleted.
VPAC2 and Astrocyte-Mediated Neuroprotection (Evidence: Animal - Delgado & Ganea, 2003, PMC)
VPAC2 receptor activation in white matter astrocytes triggers PKC (protein kinase C, a cell-signaling enzyme) and MAPK (mitogen-activated protein kinase, a signaling enzyme family involved in cell survival) activity. This produces neurotrophic effects in distant cortical neurons. VIP also enhances the release of ADNF and ADNP, proteins that directly support neuronal survival. This indirect neuroprotection mechanism - mediated through the brain's own support cell network - means VIP can exert protective effects at a distance from where it actually binds.
p38 MAPK Pathway and Intestinal Secretory Cell Differentiation (Evidence: In vitro)
VIP promotes differentiation of secretory cells in intestinal organoids through p38 MAPK pathway activation. P38 MAPK is a signaling enzyme branch that directs stem cell specialization decisions. MEK1, a related kinase in a parallel signaling branch, also contributes as a secondary mechanism. This expands Paneth cells (Lyz1+) and goblet cells (Muc2+), the specialized cells that maintain the antimicrobial and mucus layers of the gut lining. VIP knockout mice show reduced secretory markers in the colon, and the effect is reversible with exogenous VIP administration. That reversibility establishes a clean causal relationship.
ACE2 and TMPRSS2 Downregulation (Evidence: In vitro)
VIP reduces both expression and enzymatic activity of ACE2 and TMPRSS2 in epithelial cells using multiple documented measurement methods: gene expression analysis, surface protein assessment, and functional protease activity measurement. Both proteins are critical for SARS-CoV-2 cellular entry, and published cell study data documents substantial reductions in TMPRSS2 enzymatic activity.
Condition-Focused Research
Autoimmune and Inflammatory Disease Models {#research-autoimmune}
Across collagen-induced arthritis, DSS-induced colitis, and EAE (experimental autoimmune encephalomyelitis, a rodent model of multiple sclerosis) models, VIP consistently reduces disease severity through Treg induction and Th1/Th17 suppression. The VIP-SSM nanoformulation demonstrates particular effectiveness, outperforming free VIP in colitis and arthritis models, working at lower doses, and eliminating the hypotension that limits free VIP's clinical utility in these contexts. Free VIP was ineffective as a single dose in some IBD models due to rapid degradation. This establishes that formulation is not a secondary concern but a primary determinant of whether the compound works at all in these applications. (Evidence: Animal + in vitro - Abad et al., 2010, PMC)
Pulmonary Hypertension and Respiratory Disease {#research-pulmonary}
A Phase 2 sarcoidosis trial of nebulized VIP over 4 weeks established safety with no serious adverse events. A VIP-ELP fusion protein received FDA orphan drug designation for pulmonary arterial hypertension, WHO Group 1, acknowledging potential without constituting approval. VIP deficiency has been confirmed as a diagnostic marker in the serum and lung tissue of pulmonary hypertension patients. This suggests the condition involves disrupted endogenous VIP signaling rather than VIP being purely a pharmacological tool applied from outside. (Evidence: Moderate - animal + limited human)
Migraine and Cerebrovascular Effects {#research-migraine}
A randomized, double-blind, placebo-controlled crossover trial (NCT04260035) in patients with migraine without aura found that a 2-hour VIP infusion induced migraine attacks mimicking spontaneous ones. The trial documented significantly increased headache intensity and temporal artery diameter compared to placebo. This finding is notable in two directions: it confirms VIP's potent vasodilatory effects on cranial vasculature, and it establishes VIP as a potential trigger of migraine pathophysiology through cranial vasodilation rather than a therapeutic agent in this context. (Evidence: Human RCT)
Parkinson's Disease Animal Models {#research-parkinsons}
In MPTP-treated animal models of Parkinson's disease, VIP prevented loss of dopaminergic neurons in the substantia nigra pars compacta and striatum by suppressing microglial neuroinflammation. Measured outcomes included reduced iNOS (inducible nitric oxide synthase, an enzyme that produces inflammatory nitric oxide signals), IL-1beta, and TNF-alpha. Researchers also observed reduced nitrotyrosine levels (a biomarker of oxidative stress) and improved dopamine and DOPAC (a dopamine metabolite used to assess dopaminergic neuron function) levels compared to untreated animals. A 2024 LentiVIP study showed that VIP-transduced microglia could deliver neuroprotection to neuronal cells, suggesting cell-based delivery as a potential CNS strategy for future research. (Evidence: Animal - Delgado & Ganea, 2003, PMC)
CIRS and Inflammatory Marker Correction {#research-cirs}
In compounding protocols lasting up to 18 months, nasal VIP in CIRS patients was associated with correction of C4a, TGF-beta1, and MMP9 (inflammatory markers characteristically dysregulated in CIRS), as well as hormonal normalization and improvement in pulmonary pressure readings, with no serious adverse events. This body of evidence is protocol-level rather than controlled-trial-level; it lacks randomization and placebo controls. However, 18 months of documented safety and outcome data without serious adverse events carries real weight as a safety signal, even in the absence of a control group. (Evidence: Protocol-level - ISEAI)
Safety & Tolerability Research
The most significant safety data points for VIP are three. First, the Phase 2 sarcoidosis nebulization trial ran 4 weeks with no serious adverse events. Second, the CIRS nasal VIP protocol has been documented for up to 18 months with no serious adverse events. Third, the Phase 3 IV trial (n=471) was halted for futility; IV administration was previously associated with dose-limiting hypotension and tachycardia in earlier phase research. The migraine provocation trial documented a controlled adverse effect profile from IV infusion including flushing, palpitations, nausea, photophobia, cold sensations, and abdominal discomfort in a healthy research population. The VIP-SSM nanoformulation eliminated hypotension in preclinical models at equivalent therapeutic doses, demonstrating a formulation-based path to improved tolerability if the nanoformulation advances into human research.
Research Limitations
VIP's evidence base has a fundamental gap: the largest human trial (the Phase 3 IV study in 471 patients) was halted for futility, and no current Phase 2 or Phase 3 trials are identified in available data. Mechanistic and disease-model data is predominantly animal and in vitro, with human evidence concentrated in safety characterization rather than controlled efficacy demonstration. CIRS has the most extended human documentation but remains observational rather than randomized or controlled. The intranasal route (the most commonly used in practice) has no formal pharmacokinetic study in humans confirming bioavailability, brain concentration achieved, or dose-response relationship. VIP's plasma half-life of approximately 1-2 minutes makes formulation a determinant of whether effects are achievable at all, and no clinical-stage nanoformulation is currently available for human use. Additionally, preclinical data contains a notable paradox: while acute VIP administration suppresses CNS inflammation, VIP deficiency in knockout models protects against EAE by impairing CNS inflammation propagation, a contradiction that highlights how much remains unknown about chronic versus acute VIP signaling dynamics.
Is VIP Legal? Regulatory & Sports Status
FDA status: VIP is not an FDA-approved drug product for general therapeutic use. As an endogenous neuropeptide, VIP occurs naturally in the body, but endogenous status does not confer drug approval. A VIP-elastin-like peptide fusion protein received FDA orphan drug designation for pulmonary arterial hypertension, WHO Group 1; orphan designation acknowledges potential and provides certain development incentives but does not constitute approval, and the orphan indication approval status remains not approved.
Compounding status: VIP is currently available through licensed compounding pharmacies under physician supervision. However, the FDA has initiated review of whether VIP should remain on bulk drug substance lists used for compounding; reports indicate VIP faces potential removal from the FDA compounding list. The FDA has noted that certain bulk drug substances used in compounding may present significant safety risks. Compounded VIP nasal spray has not been evaluated by the FDA for safety, quality, or efficacy and is not approved for any specific disease or condition.
Research Use: VIP is available as a research-grade compound from multiple suppliers in lyophilized vial form for non-human research applications.
WADA / USADA status: VIP does not appear as a named prohibited substance in available sports doping literature, and no sports doping context for VIP was identified in the research data for this article. Available sources do not include direct verification against the current WADA Prohibited List; users subject to sports drug testing should confirm directly with WADA (wada-ama.org) and their sport's governing body before use.
Country-specific notes: VIP is not commercially approved as a drug product in the US, EU, or other major markets for general therapeutic use. In jurisdictions where compounding pharmacy access to VIP may be restricted or is currently under review, availability could change. Users are responsible for understanding their local regulatory environment.
Detection: No established sports doping detection methodology for VIP was identified in available research. As an endogenous peptide, detection methodology would need to distinguish exogenous administration from normal physiological levels, a significant analytical challenge that has not been described in publicly available testing protocols.
VIP vs. Alternatives
Commonly Paired With - Synergistic Stacks
- VIP + BPC-157: Paired in some integrative and functional medicine protocols targeting gut healing alongside immune modulation; BPC-157 addresses structural gut repair and angiogenesis while VIP contributes secretory cell support and inflammatory regulation. These compounds work through different pathways, and the combination is documented in practitioner wellness contexts, though no formal trial data on the combination exists.
- VIP + Thymosin Alpha-1 (TA-1): Used in immune support protocols where broader immune modulation is sought; TA-1 works through Th1 and innate immune enhancement while VIP shifts toward Treg and Th2 profiles, creating a complementary rather than duplicative immune effect. Practitioners in CIRS and chronic immune condition contexts have documented this pairing.
- VIP + gut-regulatory peptides: In GI-focused protocols, VIP is sometimes paired with peptides targeting motility and intestinal barrier integrity from complementary angles. This is an emerging area in functional medicine without a substantial evidence base for the specific combination.
Stacking information is for educational context; individualized stack protocols live inside MPP.
Alternatives - When Another Peptide May Be Considered
BPC-157 BPC-157 is often considered as an alternative or complement when the primary goal is gut healing or tissue repair rather than systemic immune modulation. BPC-157 has a stronger evidence base in musculoskeletal and gut healing contexts, a more established compounding protocol framework, and a different side effect profile without VIP's cardiovascular concerns. For users primarily seeking gut barrier support, BPC-157's direct cytoprotective and angiogenic focus may be more targeted than VIP's broader immune-modulating approach.
Thymosin Alpha-1 (TA-1) TA-1 is an alternative for immune modulation goals, particularly when the target is immune activation and surveillance rather than the Th2/Treg shift VIP produces. TA-1 enhances Th1 immunity and natural killer cell activity, essentially the opposite directional shift from VIP. For users with immune suppression or recurrent infection, TA-1's immune activation profile may be more appropriate; for users with autoimmune or inflammatory excess, VIP's Th1-suppression profile is more relevant.
Selank Selank is a relevant alternative for the neurological and anxiety-reducing applications that VIP's circadian rhythm and mood-modulating properties attract some users toward. Selank is a synthetic anxiolytic peptide with its own immune-modulating properties and a nasal delivery format that parallels VIP's most common route. For users drawn to VIP primarily for cognitive or anxiety applications, Selank represents a more specifically studied alternative in that domain.
Comparison table:
| Peptide | Primary Mechanism | Best For | Evidence Level | Approx. Cost |
|---|---|---|---|---|
| VIP | VPAC1/2 receptor activation; Treg induction; vasodilation | Immune modulation, inflammatory conditions, pulmonary support, CIRS | Moderate (human safety data; limited efficacy trials) | $190-$230/month (nasal compounded) |
| BPC-157 | Growth factor upregulation; angiogenesis; gut cytoprotection | Tissue repair, gut healing, musculoskeletal recovery | Moderate (animal + limited human) | $50-$80/vial |
| Thymosin Alpha-1 | Th1 immune activation; NK cell enhancement | Immune activation, chronic infection, oncology adjunct | Moderate (human data in hepatitis and cancer contexts) | $80-$150/vial |
| Selank | Anxiolytic; IL-6 modulation; BDNF support | Anxiety, cognitive support, stress response | Preliminary (animal + limited clinical) | $30-$70/vial |
Build Your Protocol
Ready to build your Vip Peptide protocol?
This guide covers what the evidence shows — the broad ranges, the mechanisms, the research, and the safety picture. What it cannot do is tell you exactly what your protocol should look like, because that depends on your health history, body weight, goals, and what else you are using.
That is what MyPeptidePal does. Tell it about yourself and your goals — it builds a complete, personalized Vip Peptide protocol in under 60 seconds. Free to try. No credit card required.
FAQs
What is VIP peptide?
VIP (Vasoactive Intestinal Peptide) is a naturally occurring 28-amino acid neuropeptide produced throughout the body - in the gut, nervous system, and immune cells - that regulates inflammation, blood vessel tone, airway smooth muscle, and immune cell behavior. Its synthetic pharmaceutical form is called aviptadil. VIP is studied for its immune-modulating, bronchodilatory, and neuroprotective properties, and is available in compounding contexts as nasal spray and subcutaneous injectable preparations under physician supervision.
What does VIP peptide do?
VIP primarily shifts the immune system from a pro-inflammatory state toward a more regulated, tolerant state, suppressing cytokines like TNF-alpha, IL-6, and IL-17A while generating regulatory T cells that prevent immune overactivation. It also dilates blood vessels and airway smooth muscle (which is why it was named vasoactive), plays a role in coordinating circadian rhythms, protects neurons from inflammatory damage in animal research, and supports the integrity of the gut lining by promoting secretory cell differentiation.
How long does VIP peptide take to work?
Timeline depends heavily on the application and route. Bronchodilatory effects can be relatively rapid with direct airway delivery, while systemic immune and inflammatory effects in documented compounding protocols typically require weeks of consistent use before measurable changes appear. CIRS protocols document correction of inflammatory markers and hormonal normalization across several months, with injectable protocols commonly structured around 3-month cycles.
What is the typical dose of VIP peptide?
Documented compounding protocols report intranasal doses generally in the range of 100-400 mcg per day, commonly split across multiple administrations. Subcutaneous injectable protocols typically fall in the 50-200 mcg per injection range. Dosing varies considerably by indication, route, and individual response, and VIP's rapid degradation in circulation means route and formulation matter as much as the dose number itself. Individualized dosing requires physician supervision, as the appropriate protocol depends on health history, goals, and ongoing monitoring of inflammatory markers.
Is VIP peptide legal?
VIP is not an FDA-approved drug product and is not commercially available as a standard pharmaceutical. In the US, it is currently accessible through licensed compounding pharmacies under physician supervision, though it is under FDA review for potential removal from bulk drug substance lists used in compounding, which could change availability. VIP is not identified as a WADA prohibited substance in available sources, but users subject to sports drug testing should verify directly with WADA and their relevant governing body before use.
Can VIP peptide be taken orally?
No. VIP is a 28-amino acid peptide degraded by gastric acid and digestive enzymes before reaching systemic circulation in meaningful concentrations. The same rapid enzymatic degradation that makes VIP problematic as a single-dose injection (and that drove researchers to develop specialized nanoparticle delivery systems) applies even more completely to the oral route. No oral VIP formulation has demonstrated systemic bioavailability in published research.
Why was the VIP Phase 3 trial halted?
The Phase 3 IV trial of VIP (the largest VIP trial to date at 471 participants) was halted for futility, meaning interim analysis indicated it was unlikely to reach its efficacy endpoints even if completed. Futility halting is not primarily a safety finding; it reflects that the treatment was not showing the expected benefit in that specific population, with that specific route and dose. The result does not invalidate VIP's other applications or routes but is the most significant negative trial data in VIP's clinical research history and should not be minimized.
Does VIP peptide cause high or low blood pressure?
VIP lowers blood pressure through potent vasodilation, meaning it relaxes the smooth muscle in blood vessel walls, causing vessels to widen and reducing vascular resistance. This is the primary dose-limiting concern with IV administration, where the effect is most pronounced. At compounding doses via nasal or subcutaneous routes the effect is generally more modest, but hypotension is still listed as a documented side effect in clinical product materials. Anyone with pre-existing low blood pressure or taking antihypertensive medications should discuss VIP use with a clinician before starting.
What is the difference between VIP and aviptadil?
Aviptadil is the pharmaceutical name for synthetic VIP, meaning the same 28-amino acid sequence manufactured synthetically rather than derived from biological sources. ZYESAMI is the brand name used in COVID-19 expanded access research involving aviptadil. Compounded VIP preparations use synthetically manufactured VIP peptide. The biological activity is the same; the terminology reflects the clinical and regulatory context in which the compound is being used.
Is nasal VIP safe for long-term use?
The most extended human safety data available is from CIRS protocols using compounded nasal VIP for up to 18 months, with no serious adverse events reported. A Phase 2 sarcoidosis trial of nebulized VIP over 4 weeks also showed no serious adverse events. These represent the best available data points for extended-duration safety, but neither constitutes a formal controlled long-term safety study with a comparison group. What can be said is that extended nasal use has been documented without serious problems in monitored clinical protocol contexts.
Final Thoughts on VIP Peptide
VIP is one of the more scientifically interesting neuropeptides in current research, not because the clinical evidence is overwhelming, but because the underlying biology is genuinely complex and the mechanisms are well-characterized at a molecular level. The Treg induction pathway, the pulmonary deficiency finding, the intranasal brain concentration advantage, the 28-amino acid sequence that degrades in minutes and still manages to shift immune profiles across multiple disease models: there is real science here, not just peptide enthusiasm.
The honest picture is more complicated than VIP's advocates sometimes present. The Phase 3 IV trial failure is not a footnote; it is the largest human efficacy dataset for VIP, and it did not show what was expected. The mechanistic evidence is mostly animal and in vitro. The human data is largely safety characterization from compounding protocols, not controlled efficacy trials. VIP also faces real practical challenges: rapid degradation, dose-limiting cardiovascular effects at IV doses, and potential compounding access restrictions under FDA review. There is also an unusual evidence paradox: the same compound that suppresses inflammation acutely appears to worsen certain chronic CNS inflammation models when absent long-term. These nuances matter for anyone approaching VIP seriously.
What VIP does have is a coherent biological rationale and a relatively established safety profile at compounded nasal doses over extended use. It also has a research trajectory that has not run out of ideas: nanoformulation development, cell-mediated CNS delivery, and the pulmonary hypertension orphan designation all represent active threads. If you are considering VIP as part of a protocol, the right starting point is building that protocol under physician supervision with a full picture of what is known and what is not. MyPeptidePal can help you map out the framework, and more importantly, flag where the gaps in your picture might be.
This guide is for educational and informational purposes only. It is not medical advice, a diagnosis, a treatment recommendation, or a suggestion to use Vip Peptide or any other compound. The information provided does not replace consultation with a qualified healthcare professional. Always consult a licensed medical provider before starting, stopping, or modifying any peptide protocol or health regimen. Individual results vary. The peptides discussed may be unapproved for human use and may be regulated differently depending on your jurisdiction. Users are responsible for understanding and complying with all applicable laws and regulations in their location.
References
About MyPeptidePal
About the Author
Marcus Reid is a functional medicine researcher, data analyst, and peptide specialist, and one of the people who built MyPeptidePal. The platform exists in part because of the years he spent immersed in clinical literature, real-world protocols, and the kind of hands-on experimentation that most textbooks skip entirely. He is not a physician and does not pretend to be. What he is, is someone who has done the work to understand how these compounds actually function at a biological level, what the research actually says versus what the forums claim, and how to explain it in a way that makes sense to anyone willing to learn. At MPP, Marcus contributed to building the knowledge base, the protocol frameworks, and the research systems that power the platform. His work covers tissue repair, metabolic health, hormonal optimization, longevity, cognitive function, and cosmetic applications. When the science gets complicated, his job is to make it click.



